PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopim06g076350.0.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family G2-like
Protein Properties Length: 323aa    MW: 36183.4 Da    PI: 5.5545
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopim06g076350.0.1genomeCSHLView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like91.95.5e-29150203155
             G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                         +prl+Wtp+LH+rF+e+v++L G++ A+Pkti++lm+v+gLt+e+v+SHLQkYRl
  Sopim06g076350.0.1 150 RPRLVWTPQLHKRFIEVVAHL-GIKGAVPKTIMQLMNVEGLTRENVASHLQKYRL 203
                         59*******************.9*******************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129410.383145206IPR017930Myb domain
SuperFamilySSF466899.14E-19147207IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.606.1E-29149208IPR009057Homeodomain-like
TIGRFAMsTIGR015573.5E-23151203IPR006447Myb domain, plants
PfamPF002492.5E-8153202IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 323 aa     Download sequence    Send to blast
MGEEVSLTDY ESSGGNDDRL LWEIGLPDVD DLTPLNMQLI PSELAAAFRI SPELSKTMTD  60
VNRASQNTFS SLQRWHSQDM ASMNNSNFKT FSYERSREET VTERDETDLI REGSDSRKLR  120
RVESGGTEEA DSSLCNENFA DDSSAKTLKR PRLVWTPQLH KRFIEVVAHL GIKGAVPKTI  180
MQLMNVEGLT RENVASHLQK YRLYTKRMQP NEGPSSSDHL LTSTPATEIM RESSESGHLR  240
NTNGHMAMPT LMPYQQQMVA MPMMGMPNGG HVGMPVGYGG GPPLGFHHHY NVVQQRDWSG  300
NNFGYYHPVA SNDKYVDLDD VI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A2e-19149208463ARR10-B
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755180.0HG975518.1 Solanum lycopersicum chromosome ch06, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010322338.10.0PREDICTED: transcription factor PCL1-like
RefseqXP_004241214.10.0PREDICTED: transcription factor PCL1-like
RefseqNP_001308215.10.0transcription factor PCL1
SwissprotQ9SNB44e-71PCL1_ARATH; Transcription factor LUX
TrEMBLK4C9Z50.0K4C9Z5_SOLLC; Uncharacterized protein
STRINGSolyc06g076350.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA35802343
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G46640.25e-70G2-like family protein